Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIsoprenylcysteine carboxyl methyltransferase
LigandBDBM50174224
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321482
IC50 14000±n/a nM
Citation Henriksen BSAnderson JLHrycyna CAGibbs RA Synthesis of desthio prenylcysteine analogs: sulfur is important for biological activity. Bioorg Med Chem Lett 15:5080-3 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Isoprenylcysteine carboxyl methyltransferase
Name:Isoprenylcysteine carboxyl methyltransferase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:27893.87
Organism:Saccharomyces cerevisiae
Description:ChEMBL_321482
Residue:239
Sequence:
MHQDFQEDEHEYPDIRRNPLHEVTMTSYILGILLGIFVGLFPQIRFKNFNLFIIALSLFH
FLEYYITAKYNPLKVHSESFLLNNGKSYMAAHSFAILECLVESFLFPDLKIFSYSLATKL
CTVLGCLLVILGQYTRTIAMHTAGHSFSHIVKTKKESDHVLVKTGVYSWSRHPSYLGFFW
WAIGTQLLLLNPLSLVIFIFVLWKFFSDRIRVEEKYLIEFFSAEYIEYKNKVGVGIPFI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50174224
n/a
NameBDBM50174224
Synonyms:(R)-2-Acetylamino-3-[(2Z,6E)-7,11-dimethyl-3-(3-methyl-but-2-enyl)-dodeca-2,6,10-trienylsulfanyl]-propionic acid anion
TypeSmall organic molecule
Emp. Form.C24H38NO3S
Mol. Mass.420.629
SMILES[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6]\[#6]=[#6](/[#6])-[#6])=[#6]\[#6]-[#16]-[#6]-[#6@H](-[#7]-[#6](-[#6])=O)-[#6](-[#8-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: