Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMycothiol S-conjugate amidase
LigandBDBM50117090
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321414
IC50 2800±n/a nM
Citation Nicolaou KC Joys of molecules. 2. Endeavors in chemical biology and medicinal chemistry. J Med Chem 48:5613-38 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mycothiol S-conjugate amidase
Name:Mycothiol S-conjugate amidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32719.79
Organism:Mycobacterium tuberculosis
Description:ChEMBL_626858
Residue:288
Sequence:
MSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNPAMDLPDVHGR
IAEIRRDEMTKAAEILGVEHTWLGFVDSGLPKGDLPPPLPDDCFARVPLEVSTEALVRVV
REFRPHVMTTYDENGGYPHPDHIRCHQVSVAAYEAAGDFCRFPDAGEPWTVSKLYYVHGF
LRERMQMLQDEFARHGQRGPFEQWLAYWDPDHDFLTSRVTTRVECSKYFSQRDDALRAHA
TQIDPNAEFFAAPLAWQERLWPTEEFELARSRIPARPPETELFAGIEP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50117090
n/a
NameBDBM50117090
Synonyms:(E,E)-Psammaplin A | 3-(3-Bromo-4-hydroxy-phenyl)-N-(2-{2-[3-(3-bromo-4-hydroxy-phenyl)-2-hydroxyimino-propionylamino]-ethyldisulfanyl}-ethyl)-2-[(E)-hydroxyimino]-propionamide | 3-(3-Bromo-4-hydroxy-phenyl)-N-(2-{2-[3-(3-bromo-4-hydroxy-phenyl)-2-hydroxyimino-propionylamino]-ethyldisulfanyl}-ethyl)-2-hydroxyimino-propionamide | 3-(3-Bromo-4-hydroxy-phenyl)-N-[2-(2-{3-(3-bromo-4-hydroxy-phenyl)-2-[(E)-hydroxyimino]-propionylamino}-ethyldisulfanyl)-ethyl]-2-[(E)-hydroxyimino]-propionamide | 3-(3-bromo-4-hydroxy-phenyl)-N-[2-(2-{3-(3-bromo-4-hydroxy-phenyl)-2-[hydroxyimino]-propionylamino}-ethyldisulfanyl)-ethyl]-2-[hydroxyimino]-propionamide | CHEMBL83747 | Psammaplin A
TypeSmall organic molecule
Emp. Form.C22H24Br2N4O6S2
Mol. Mass.664.387
SMILESOc1ccc(CC(N=O)C(=O)NCCSSCCNC(=O)C(Cc2ccc(O)c(Br)c2)N=O)cc1Br
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: