| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cytochrome c oxidase subunit NDUFA4 |
|---|
| Ligand | BDBM50172374 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_321337 (CHEMBL880621) |
|---|
| IC50 | 18±n/a nM |
|---|
| Citation |  Nicolaou, KC Joys of molecules. 2. Endeavors in chemical biology and medicinal chemistry. J Med Chem48:5613-38 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cytochrome c oxidase subunit NDUFA4 |
|---|
| Name: | Cytochrome c oxidase subunit NDUFA4 |
|---|
| Synonyms: | NADH-ubiquinone oxidoreductase MLRQ subunit | NDUA4_HUMAN | NDUFA4 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 9374.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_321338 |
|---|
| Residue: | 81 |
|---|
| Sequence: | MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPND
QYKFYSVNVDYSKLKKERPDF
|
|
|
|---|
| BDBM50172374 |
|---|
| n/a |
|---|
| Name | BDBM50172374 |
|---|
| Synonyms: | 2,2-Dimethyl-6-[1-(3,4,5-trimethoxy-benzyl)-vinyl]-chroman | CHEMBL197472 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H28O4 |
|---|
| Mol. Mass. | 368.466 |
|---|
| SMILES | COc1cc(CC(=C)c2ccc3OC(C)(C)CCc3c2)cc(OC)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
