Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeptidyl-prolyl cis-trans isomerase FKBP1A
LigandBDBM50172395
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321244
IC50 9.6±n/a nM
Citation Nicolaou KC Joys of molecules. 2. Endeavors in chemical biology and medicinal chemistry. J Med Chem 48:5613-38 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peptidyl-prolyl cis-trans isomerase FKBP1A
Name:Peptidyl-prolyl cis-trans isomerase FKBP1A
Synonyms:12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKBP-12 | FKBP-1A | FKBP12 | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase
Type:Isomerase
Mol. Mass.:11953.09
Organism:Homo sapiens (Human)
Description:P62942
Residue:108
Sequence:
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50172395
n/a
NameBDBM50172395
Synonyms:(1R,9S,12R,21S,22S,24S,27R)-1-Hydroxy-22-methoxy-17,21,27-trimethyl-12-phenethyl-20,28-dioxa-4,11,14,17-tetraaza-tricyclo[22.3.1.0*4,9*]octacosane-2,3,10,13,16,19-hexaone | CHEMBL371029
TypeSmall organic molecule
Emp. Form.C34H48N4O10
Mol. Mass.672.7657
SMILESCO[C@H]1C[C@@H]2CC[C@@H](C)[C@@](O)(O2)C(=O)C(=O)N2CCCC[C@H]2C(=O)N[C@H](CCc2ccccc2)C(=O)NCC(=O)N(C)CC(=O)O[C@H]1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: