Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium-dependent serotonin transporter
LigandBDBM50173715
Substrate/Competitorn/a
Meas. Tech.ChEMBL_320823
Ki 0.18±n/a nM
Citation Mattson RJCatt JDDenhart DJDeskus JADitta JLHiggins MAMarcin LRSloan CPBeno BRGao QCunningham MAMattson GKMolski TFTaber MTLodge NJ Conformationally restricted homotryptamines. 2. Indole cyclopropylmethylamines as selective serotonin reuptake inhibitors. J Med Chem 48:6023-34 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium-dependent serotonin transporter
Name:Monoamine transporter
Synonyms:5-HT Transporter | 5HT transporter | 5HTT | SERT | SLC6A4 | Serotonin Transporter (SERT) | Serotonin transporter (5HTT) | Serotonin transporter protein (SERT) | Sodium-dependent serotonin transporter (SERT) | Solute carrier family 6 member 4
Type:Multi-pass membrane protein
Mol. Mass.:70322.51
Organism:Homo sapiens (Human)
Description:P31645
Residue:630
Sequence:
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR
HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM
AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH
RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA
TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT
LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT
PGTFKERIIKSITPETPTEIPCGDIRLNAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50173715
n/a
NameBDBM50173715
Synonyms:(+)3-((1S,2S)-2-Dimethylaminomethyl-cyclopropyl)-1H-indole-5-carbonitrile | 3-((1S,2S)-2-((dimethylamino)methyl)cyclopropyl)-1H-indole-5-carbonitrile | 3-((1S,2S)-2-Dimethylaminomethyl-cyclopropyl)-1H-indole-5-carbonitrile | CHEMBL196468
TypeSmall organic molecule
Emp. Form.C15H17N3
Mol. Mass.239.3156
SMILESCN(C)C[C@H]1C[C@@H]1c1c[nH]c2ccc(cc12)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: