Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamine synthetase
LigandBDBM50174521
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321474
pH7.4±n/a
IC50 33000±n/a nM
Commentsextracted
Citation Berlicki LObojska AForlani GKafarski P Design, synthesis, and activity of analogues of phosphinothricin as inhibitors of glutamine synthetase. J Med Chem 48:6340-9 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamine synthetase
Name:Glutamine synthetase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:51891.08
Organism:Escherichia coli (strain K12)
Description:ChEMBL_321474
Residue:469
Sequence:
MSAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNAEFFEEGKMFDGSSIGGWKG
INESDMVLMPDASTAVIDPFFADSTLIIRCDILEPGTLQGYDRDPRSIAKRAEDYLRSTG
IADTVLFGPEPEFFLFDDIRFGSSISGSHVAIDDIEGAWNSSTQYEGGNKGHRPAVKGGY
FPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYK
YVVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLSKNGVNLFAGDKYAGLSEQALYYIG
GVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNRSASIRIPVVSSPKARRIEVR
FPDPAANPYLCFAALLMAGLDGIKNKIHPGEAMDKNLYDLPPEEAKEIPQVAGSLEEALN
ELDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFELYYSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50174521
n/a
NameBDBM50174521
Synonyms:(S)-2-Amino-4-[((S)-1-amino-ethyl)-hydroxy-phosphinoyl]-butyric acid; hydrochloride | CHEMBL539335 | CHEMBL557574
TypeSmall organic molecule
Emp. Form.C6H15N2O4P
Mol. Mass.210.1681
SMILESCC(=N)P(O)(O)CC[C@H](N)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: