Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM50010859
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321555
IC50 4.4±n/a nM
Citation Minetti PTinti MOCarminati PCastorina MDi Cesare MADi Serio SGallo GGhirardi OGiorgi FGiorgi LPiersanti GBartoccini FTarzia G 2-n-Butyl-9-methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine and analogues as A2A adenosine receptor antagonists. Design, synthesis, and pharmacological characterization. J Med Chem 48:6887-96 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A3
Name:Adenosine receptor
Synonyms:A3 adenosine receptor (hA3) | Adenosine A3 receptor (A3AR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36197.32
Organism:Homo sapiens (Human)
Description:P0DMS8
Residue:318
Sequence:
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010859
n/a
NameBDBM50010859
Synonyms:CHEMBL11 | IMIPRAMINE HYDROCHLORIDE | IMIPRAMINE PAMOATE | Imipramin
TypeSmall organic molecule
Emp. Form.C19H24N2
Mol. Mass.280.4073
SMILESCN(C)CCCN1c2ccccc2CCc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: