Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50179269 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_325587 (CHEMBL860170) |
---|
Ki | 0.42±n/a nM |
---|
Citation | Berardi, F; Ferorelli, S; Abate, C; Pedone, MP; Colabufo, NA; Contino, M; Perrone, R Methyl substitution on the piperidine ring of N-[omega-(6-methoxynaphthalen-1-yl)alkyl] derivatives as a probe for selective binding and activity at the sigma(1) receptor. J Med Chem48:8237-44 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50179269 |
---|
n/a |
---|
Name | BDBM50179269 |
Synonyms: | 1-(4-(6-methoxy-1,2,3,4-tetrahydronaphthalen-1-yl)butyl)-4-methylpiperidine hydrochloride | CHEMBL540573 |
Type | Small organic molecule |
Emp. Form. | C21H33NO |
Mol. Mass. | 315.4928 |
SMILES | COc1ccc2C(CCCCN3CCC(C)CC3)CCCc2c1 |
Structure |
|