Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V1a receptor
LigandBDBM50178176
Substrate/Competitorn/a
Meas. Tech.ChEMBL_326539
Ki 115±n/a nM
Citation Quattropani ADorbais JCovini DPittet PAColovray VThomas RJCoxhead RHalazy SScheer AMissotten MAyala GBradshaw CDe Raemy-Schenk AMNichols ACirillo RTos EGGiachetti CGolzio LMarinelli PChurch DJBarberis CChollet ASchwarz MK Discovery and development of a new class of potent, selective, orally active oxytocin receptor antagonists. J Med Chem 48:7882-905 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V1a receptor
Name:Vasopressin V1a receptor
Synonyms:AVPR V1a | AVPR1 | AVPR1A | Antidiuretic hormone receptor 1a | V1aR | VASOPRESSIN V1A | Vascular/hepatic-type arginine vasopressin receptor | Vasopressin V1 receptor
Type:Receptor
Mol. Mass.:46820.18
Organism:Homo sapiens (Human)
Description:P37288
Residue:418
Sequence:
MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAV
TFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGP
DWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFV
LSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC
YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY
IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCV
QSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50178176
n/a
NameBDBM50178176
Synonyms:CHEMBL373167 | N-(2-(3,4-dihydroisoquinolin-2(1H)-yl)-2-oxoethyl)-N-(4-methoxyphenyl)benzenesulfonamide
TypeSmall organic molecule
Emp. Form.C24H24N2O4S
Mol. Mass.436.523
SMILESCOc1ccc(cc1)N(CC(=O)N1CCc2ccccc2C1)S(=O)(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: