Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C
LigandBDBM50174025
Substrate/Competitorn/a
Meas. Tech.ChEMBL_326771
IC50 0.7±n/a nM
Citation Macdonald DMastracchio APerrier HDubé DGallant MLacombe PDeschênes DRoy BScheigetz JBateman KLi CTrimble LADay SChauret NNicoll-Griffith DASilva JMHuang ZLaliberté FLiu SEthier DPon DMuise EBoulet LChan CCStyhler ACharleson SMancini JMasson PClaveau DNicholson DTurner MYoung RNGirard Y Discovery of a substituted 8-arylquinoline series of PDE4 inhibitors: structure-activity relationship, optimization, and identification of a highly potent, well tolerated, PDE4 inhibitor. Bioorg Med Chem Lett 15:5241-6 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4C
Name:Phosphodiesterase 4 and 5 (PDE4 and PDE5)
Synonyms:DPDE1 | PDE21 | PDE4C2 | Phosphodiesterase 4C
Type:PROTEIN
Mol. Mass.:79875.54
Organism:Homo sapiens (Human)
Description:ChEMBL_864910
Residue:712
Sequence:
MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERD
LSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQSSPGLGRIMQAPVPHSQRRESF
LYRSDSDYELSPKAMSRNSSVASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQCLGA
AKQGPVGNPSSSNQLPPAEDTGQKLALETLDELDWCLDQLETLQTRHSVGEMASNKFKRI
LNRELTHLSETSRSGNQVSEYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSA
SLSSATVPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAIIFSIFQERDLL
KTFQIPADTLATYLLMLEGHYHANVAYHNSLHAADVAQSTHVLLATPALEAVFTDLEILA
ALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQAENCDIFQNL
SAKQRLSLRRMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQN
LVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGF
IDYIAHPLWETWADLVHPDAQDLLDTLEDNREWYQSKIPRSPSDLTNPERDGPDRFQFEL
TLEEAEEEDEEEEEEGEETALAKEALELPDTELLSPEAGPDPGDLPLDNQRT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50174025
n/a
NameBDBM50174025
Synonyms:6-isopropyl-8-(3-(2-(4-(methylsulfonyl)phenyl)-2-(thiazol-2-yl)vinyl)phenyl)quinoline | CHEMBL196969
TypeSmall organic molecule
Emp. Form.C30H26N2O2S2
Mol. Mass.510.67
SMILESCC(C)c1cc(-c2cccc(\C=C(\c3nccs3)c3ccc(cc3)S(C)(=O)=O)c2)c2ncccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: