Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50165019
Substrate/Competitorn/a
Meas. Tech.ChEMBL_327856
Ki 16±n/a nM
Citation Starck JPTalaga PQuéré LCollart PChristophe BLo Brutto PJadot SChimmanamada DZanda MWagner AMioskowski CMassingham RGuyaux M Potent anti-muscarinic activity in a novel series of quinuclidine derivatives. Bioorg Med Chem Lett 16:373-7 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50165019
n/a
NameBDBM50165019
Synonyms:4-(Diethylamino)-2-butynyl alpha-phenylcyclohexaneglycolic acid ester | 4-(diethylamino)but-2-yn-1-yl cyclohexyl(hydroxy)phenylacetate | 4-Diethylamino-2-butinyl alpha-cyclohexylmandelat | 4-Diethylamino-2-butynyl alpha-phenylcyclohexaneglycolate | Benzeneacetic acid, alpha-cyclohexyl-alpha-hydroxy-, 4-(diethylamino)-2-butynyl ester | CHEMBL1231 | Cyclohexaneglycolic acid, alpha-phenyl-, 4-(diethylamino)-2-butynyl ester | OXYBUTYNIN CHLORIDE
TypeSmall organic molecule
Emp. Form.C22H31NO3
Mol. Mass.357.4864
SMILESCCN(CC)CC#CCOC(=O)C(O)(C1CCCCC1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: