Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M3
LigandBDBM50165008
Substrate/Competitorn/a
Meas. Tech.ChEMBL_327855
Ki 3.2±n/a nM
Citation Starck JPTalaga PQuéré LCollart PChristophe BLo Brutto PJadot SChimmanamada DZanda MWagner AMioskowski CMassingham RGuyaux M Potent anti-muscarinic activity in a novel series of quinuclidine derivatives. Bioorg Med Chem Lett 16:373-7 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M3
Name:Muscarinic acetylcholine receptor M1 and M3
Synonyms:CHRM3 | Cholinergic, muscarinic M3 | Muscarinic Receptors M3 | Muscarinic receptor M3 | RecName: Full=Muscarinic acetylcholine receptor M3
Type:Enzyme
Mol. Mass.:66151.03
Organism:Homo sapiens (Human)
Description:P20309
Residue:590
Sequence:
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50165008
n/a
NameBDBM50165008
Synonyms:(+)-(R)-2-(alpha-(2-(Diisopropylamino)ethyl)benzyl)-p-cresol | (+)-Tolterodine | 2-[(1R)-3-(diisopropylamino)-1-phenylpropyl]-4-methylphenol | CHEMBL1382 | TOLTERODINE
TypeSmall organic molecule
Emp. Form.C22H31NO
Mol. Mass.325.4876
SMILESCC(C)N(CC[C@H](c1ccccc1)c1cc(C)ccc1O)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: