Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M3
LigandBDBM50176725
Substrate/Competitorn/a
Meas. Tech.ChEMBL_327855
Ki 4±n/a nM
Citation Starck JPTalaga PQuéré LCollart PChristophe BLo Brutto PJadot SChimmanamada DZanda MWagner AMioskowski CMassingham RGuyaux M Potent anti-muscarinic activity in a novel series of quinuclidine derivatives. Bioorg Med Chem Lett 16:373-7 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M3
Name:Muscarinic acetylcholine receptor M1 and M3
Synonyms:CHRM3 | Cholinergic, muscarinic M3 | Muscarinic Receptors M3 | Muscarinic receptor M3 | RecName: Full=Muscarinic acetylcholine receptor M3
Type:Enzyme
Mol. Mass.:66151.03
Organism:Homo sapiens (Human)
Description:P20309
Residue:590
Sequence:
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50176725
n/a
NameBDBM50176725
Synonyms:1-cyclopentyl-3-(3-methoxyquinuclidin-3-yl)-1-(pyridin-2-yl)prop-2-yn-1-ol | CHEMBL370862
TypeSmall organic molecule
Emp. Form.C21H28N2O2
Mol. Mass.340.4592
SMILESCOC1(CN2CCC1CC2)C#CC(O)(C1CCCC1)c1ccccn1 |THB:1:2:5.6:9.8,(-4.54,-3.86,;-3.01,-3.86,;-2.24,-5.21,;-1.71,-6.49,;-.39,-5.47,;1.09,-5.74,;.48,-4.47,;-.98,-4.22,;-1.32,-2.62,;-.61,-3.58,;-3.59,-5.96,;-4.94,-6.72,;-6.28,-7.47,;-7.03,-6.13,;-5.53,-8.81,;-6.17,-10.21,;-5.04,-11.26,;-3.7,-10.5,;-4,-9,;-7.63,-8.23,;-7.65,-9.77,;-8.99,-10.53,;-10.32,-9.74,;-10.3,-8.19,;-8.96,-7.44,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: