Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAnandamide amidohydrolase
LigandBDBM50175109
Substrate/Competitorn/a
Meas. Tech.ChEMBL_328735
IC50>25000±n/a nM
Citation Urbani PCavallo PCascio MGBuonerba MDe Martino GDi Marzo VSaturnino C New metabolically stable fatty acid amide ligands of cannabinoid receptors: Synthesis and receptor affinity studies. Bioorg Med Chem Lett 16:138-41 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Anandamide amidohydrolase
Name:Anandamide amidohydrolase
Synonyms:Anandamide amidohydrolase 1 | FAAH | Fatty Acid Amide Hydrolase | Fatty Acid Amide Hydrolic, FAAH | Fatty-acid amide hydrolase (FAAH) | Fatty-acid amide hydrolase 1 | Fatty-acid amide hydrolase 1 (FAAH) | Oleamide hydrolase 1
Type:Single-pass membrane protein; homodimer
Mol. Mass.:63364.46
Organism:Rattus norvegicus (rat)
Description:Membranes prepared from rat brain were used in assay.
Residue:579
Sequence:
MVLSEVWTTLSGVSGVCLACSLLSAAVVLRWTGRQKARGAATRARQKQRASLETMDKAVQ
RFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTD
CETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAV
PFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCE
HLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTL
IPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSL
LLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALD
LNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMK
NSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50175109
n/a
NameBDBM50175109
Synonyms:CHEMBL199649 | N-(2,4-dimethoxyphenethyl)oleamide
TypeSmall organic molecule
Emp. Form.C28H47NO3
Mol. Mass.445.6777
SMILESCCCCCCCC\C=C/CCCCCCCC(=O)NCCc1ccc(OC)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: