Reaction Details |
| Report a problem with these data |
Target | Cannabinoid receptor 2 |
---|
Ligand | BDBM50072775 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_329835 (CHEMBL854384) |
---|
Ki | 15.4±n/a nM |
---|
Citation | Stern, E; Muccioli, GG; Millet, R; Goossens, JF; Farce, A; Chavatte, P; Poupaert, JH; Lambert, DM; Depreux, P; Hénichart, JP Novel 4-oxo-1,4-dihydroquinoline-3-carboxamide derivatives as new CB2 cannabinoid receptors agonists: synthesis, pharmacological properties and molecular modeling. J Med Chem49:70-9 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cannabinoid receptor 2 |
---|
Name: | Cannabinoid receptor 2 |
Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 39690.94 |
Organism: | Homo sapiens (Human) |
Description: | P34972 |
Residue: | 360 |
Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
BDBM50072775 |
---|
n/a |
---|
Name | BDBM50072775 |
Synonyms: | 2-((1R,2R,5R)-5-hydroxy-2-(3-hydroxypropyl)cyclohexyl)-5-(2-methyloctan-2-yl)phenol | 5-(1,1-Dimethyl-heptyl)-2-[(1R,2R,5R)-5-hydroxy-2-(3-hydroxy-propyl)-cyclohexyl]-phenol | 5-(1,1-Dimethyl-heptyl)-2-[(4R,6R)-5-hydroxy-2-((R)-3-hydroxy-propyl)-cyclohexyl]-phenol | CHEMBL48552 | CP-55940 | CP-55940 [(-)-AC],XIV | CP55,940 | CP55940 | ChEMBL_75020 |
Type | Small organic molecule |
Emp. Form. | C24H40O3 |
Mol. Mass. | 376.5726 |
SMILES | CCCCCCC(C)(C)c1ccc([C@@H]2C[C@H](O)CC[C@H]2CCCO)c(O)c1 |r| |
Structure |
|