Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-oxoacyl-[acyl-carrier-protein] synthase 2
LigandBDBM50180123
Substrate/Competitorn/a
Meas. Tech.ChEMBL_330092
IC50>1000000±n/a nM
Citation Kim PZhang YMShenoy GNguyen QABoshoff HIManjunatha UHGoodwin MBLonsdale JPrice ACMiller DJDuncan KWhite SWRock COBarry CEDowd CS Structure-activity relationships at the 5-position of thiolactomycin: an intact (5R)-isoprene unit is required for activity against the condensing enzymes from Mycobacterium tuberculosis and Escherichia coli. J Med Chem 49:159-71 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
3-oxoacyl-[acyl-carrier-protein] synthase 2
Name:3-oxoacyl-[acyl-carrier-protein] synthase 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:44268.74
Organism:Mycobacterium tuberculosis
Description:ChEMBL_330092
Residue:417
Sequence:
MTELVTGKAFPYVVVTGIAMTTALATDAETTWKLLLDRQSGIRTLDDPFVEEFDLPVRIG
GHLLEEFDHQLTRIELRRMGYLQRMSTVLSRRLWENAGSPEVDTNRLMVSIGTGLGSAEE
LVFSYDDMRARGMKAVSPLTVQKYMPNGAAAAVGLERHAKAGVMTPVSACASGAEAIARA
WQQIVLGEADAAICGGVETRIEAVPIAGFAQMRIVMSTNNDDPAGACRPFDRDRDGFVFG
EGGALLLIETEEHAKARGANILARIMGASITSDGFHMVAPDPNGERAGHAITRAIQLAGL
APGDIDHVNAHATGTQVGDLAEGRAINNALGGNRPAVYAPKSALGHSVGAVGAVESILTV
LALRDQVIPPTLNLVNLDPEIDLDVVAGEPRPGNYRYAINNSFGFGGHNVAIAFGRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50180123
n/a
NameBDBM50180123
Synonyms:3,5-dimethyl-4-hydroxy-5-(3-methylbutyl)-5H-thiophen-2-one | CHEMBL202928
TypeSmall organic molecule
Emp. Form.C11H18O2S
Mol. Mass.214.324
SMILESCC(C)CCC1(C)SC(=O)C(C)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: