Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-ketoacyl-ACP synthase III (FabH)
LigandBDBM50173516
Substrate/Competitorn/a
Meas. Tech.ChEMBL_330090
IC50 100000±n/a nM
Citation Kim PZhang YMShenoy GNguyen QABoshoff HIManjunatha UHGoodwin MBLonsdale JPrice ACMiller DJDuncan KWhite SWRock COBarry CEDowd CS Structure-activity relationships at the 5-position of thiolactomycin: an intact (5R)-isoprene unit is required for activity against the condensing enzymes from Mycobacterium tuberculosis and Escherichia coli. J Med Chem 49:159-71 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-ketoacyl-ACP synthase III (FabH)
Name:Beta-ketoacyl-ACP synthase III (FabH)
Synonyms:3-oxoacyl-[acyl-carrier-protein] synthase | 3-oxoacyl-[acyl-carrier-protein] synthase 3 | 3-oxoacyl-[acyl-carrier-protein] synthase III
Type:Enzyme
Mol. Mass.:33506.68
Organism:Escherichia coli
Description:C3TDZ2
Residue:317
Sequence:
MYTKIIGTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAAT
RAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALS
VADQYVKSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASEEPGIISTHLH
ADGSYGELLTLPNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLAANNLDRSQLDW
LVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPGQLVL
LEAFGGGFTWGSALVRF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50173516
n/a
NameBDBM50173516
Synonyms:3,5-dimethyl-5-((2E)-3,7-dimethyloct-2,6-dienyl)-4-hydroxy-5H-thiophen-2-one | 5-((E)-3,7-Dimethyl-octa-2,6-dienyl)-4-hydroxy-3,5-dimethyl-5H-thiophen-2-one | CHEMBL197346
TypeSmall organic molecule
Emp. Form.C16H24O2S
Mol. Mass.280.426
SMILES[#6]-[#6]-1-[#6](=O)-[#16]C([#6])([#6]\[#6]=[#6](/[#6])-[#6]-[#6]\[#6]=[#6](\[#6])-[#6])[#6]-1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: