Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstradiol receptor beta (ERβ)
LigandBDBM50181362
Substrate/Competitorn/a
Meas. Tech.ChEMBL_331402
Ki 0.5±n/a nM
Citation Wallace OBLauwers KSDodge JAMay SACalvin JRHinklin RBryant HUShetler PKAdrian MDGeiser AGSato MBurris TP A selective estrogen receptor modulator for the treatment of hot flushes. J Med Chem 49:843-6 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Estradiol receptor beta (ERβ)
Name:Estrogen receptor
Synonyms:ER-beta | Estrogen receptor | Estrogen receptor (ER beta) | Estrogen receptor beta (ER beta) | Estrogen receptor beta (ER) | Nuclear receptor subfamily 3 group A member 2 | estrogen beta
Type:Protein
Mol. Mass.:59238.43
Organism:Homo sapiens (Human)
Description:Q92731
Residue:530
Sequence:
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH
NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL
VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK
CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50181362
n/a
NameBDBM50181362
Synonyms:(R)-(+)-7,9-difluoro-5-[4-(2-piperidin-1-ylethoxy)phenyl]-5H-6-oxachrysen-2-ol hydrochloride | CHEMBL535158
TypeSmall organic molecule
Emp. Form.C30H27F2NO3
Mol. Mass.487.5371
SMILESOc1ccc2c3[C@H](Oc4c(F)cc(F)cc4-c3ccc2c1)c1ccc(OCCN2CCCCC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: