Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50178815 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_340965 (CHEMBL866517) |
---|
Ki | 2.4±n/a nM |
---|
Citation | Ekegren, JK; Ginman, N; Johansson, A; Wallberg, H; Larhed, M; Samuelsson, B; Unge, T; Hallberg, A Microwave-accelerated synthesis of P1'-extended HIV-1 protease inhibitors encompassing a tertiary alcohol in the transition-state mimicking scaffold. J Med Chem49:1828-32 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50178815 |
---|
n/a |
---|
Name | BDBM50178815 |
Synonyms: | ((1S)-1-{N'-(4-Bromo-benzyl)-N'-[(2S)-2-hydroxy-2-((1S,2R)-2-hydroxy-indan-1-ylcarbamoyl)-3-phenyl-propyl]-hydrazinocarbonyl}-2,2-dimethyl-propyl)-carbamic acid methyl ester | 3-AMINO-3-BENZYL-[4.3.0]BICYCLO-1,6-DIAZANONAN-2-ONE | CHEMBL197500 | Methyl(S)-1-(((S)-2-benzyl-2-hydroxy-3-((1S,2R)-2-hydroxy-2,3-dihydro-1H-inden-1-ylamino)-3-oxopropyl)(4-bromobenzyl)amino)-3,3-dimethyl-1-oxobutan-2-ylcarbamate | {(1S)-1-[N'-(4-bromo-benzyl)-N'-[(2S)-2-hydroxy-2-((1S,2R)-2-hydroxy-indan-1-ylcarbamoyl)-3-phenyl-propyl]-hydrazinocarbonyl]-2,2-dimethyl-propyl}-carbamic acid methyl ester |
Type | Small organic molecule |
Emp. Form. | C34H41BrN4O6 |
Mol. Mass. | 681.617 |
SMILES | COC(=O)N[C@H](C(=O)NN(Cc1ccc(Br)cc1)C[C@@](O)(Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12)C(C)(C)C |
Structure |
|