| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50185959 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_352426 (CHEMBL859957) |
|---|
| Ki | 0.098±n/a nM |
|---|
| Citation |  Zhang, MR; Ogawa, M; Maeda, J; Ito, T; Noguchi, J; Kumata, K; Okauchi, T; Suhara, T; Suzuki, K [2-11C]isopropyl-, [1-11C]ethyl-, and [11C]methyl-labeled phenoxyphenyl acetamide derivatives as positron emission tomography ligands for the peripheral benzodiazepine receptor: radiosynthesis, uptake, and in vivo binding in brain. J Med Chem49:2735-42 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50185959 |
|---|
| n/a |
|---|
| Name | BDBM50185959 |
|---|
| Synonyms: | CHEMBL381602 | N-(2-ethoxybenzyl)-N-(4-chloro-2-phenoxyphenyl)acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H22ClNO3 |
|---|
| Mol. Mass. | 395.879 |
|---|
| SMILES | CCOc1ccccc1CN(C(C)=O)c1ccc(Cl)cc1Oc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
