Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDelta-type opioid receptor
LigandBDBM50027229
Substrate/Competitorn/a
Meas. Tech.ChEMBL_366644
Ki 0.035000±n/a nM
Citation Ballet SSalvadori STrapella CBryant SDJinsmaa YLazarus LHNegri LGiannini ELattanzi RTourwé DBalboni G New 2',6'-dimethyl-L-tyrosine (Dmt) opioid peptidomimetics based on the Aba-Gly scaffold. Development of unique mu-opioid receptor ligands. J Med Chem 49:3990-3 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Delta-type opioid receptor
Name:Delta-type opioid receptor
Synonyms:D-OR-1 | DOR-1 | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRK1 | opioid receptor, delta 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40382.98
Organism:Homo sapiens (Human)
Description:Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor.
Residue:372
Sequence:
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027229
n/a
NameBDBM50027229
Synonyms:CHEMBL2375157
TypeSmall organic molecule
Emp. Form.C32H37N5O3
Mol. Mass.539.6679
SMILESC[C@@H](CN1Cc2ccccc2C[C@H]1C(=O)NCC(=O)NCc1nc2ccccc2[nH]1)Cc1c(C)cc(O)cc1C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: