| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Heme oxygenase 1 |
|---|
| Ligand | BDBM50183058 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_368935 (CHEMBL869046) |
|---|
| IC50 | 2600±n/a nM |
|---|
| Citation |  Vlahakis, JZ; Kinobe, RT; Bowers, RJ; Brien, JF; Nakatsu, K; Szarek, WA Imidazole-dioxolane compounds as isozyme-selective heme oxygenase inhibitors. J Med Chem49:4437-41 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Heme oxygenase 1 |
|---|
| Name: | Heme oxygenase 1 |
|---|
| Synonyms: | HMOX1_RAT | HSP32 | Heme Oxygenase 1 (HO-1) | Heme oxygenase 1 | Hmox1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 33005.15 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | HO-1 obtained from rat spleen was used in enzyme assays. |
|---|
| Residue: | 289 |
|---|
| Sequence: | MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHE
VGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQ
LYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRP
ASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
|
|
|
|---|
| BDBM50183058 |
|---|
| n/a |
|---|
| Name | BDBM50183058 |
|---|
| Synonyms: | (2R,4S)-2-[2-(4-chlorophenyl)ethyl]-2-[(1H-imidazol-1-yl)-methyl]-4-methyl-1,3-dioxolane hydrochloride | 1-(((2R,4S)-2-(4-chlorophenethyl)-4-methyl-1,3-dioxolan-2-yl)methyl)-1H-imidazole hydrochloride | CHEMBL535613 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H19ClN2O2 |
|---|
| Mol. Mass. | 306.787 |
|---|
| SMILES | C[C@H]1CO[C@@](CCc2ccc(Cl)cc2)(Cn2ccnc2)O1 |
|---|
| Structure | 
|
|---|
Search and Browse
