Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin D
LigandBDBM50189984
Substrate/Competitorn/a
Meas. Tech.ChEMBL_405298
IC50 231500±n/a nM
Citation Srivastava VSaxena HOShanker KKumar JKLuqman SGupta MMKhanuja SPNegi AS Synthesis of gallic acid based naphthophenone fatty acid amides as cathepsin D inhibitors. Bioorg Med Chem Lett 16:4603-8 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin D
Name:Cathepsin D
Synonyms:Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor
Type:Enzyme
Mol. Mass.:44551.72
Organism:Homo sapiens (Human)
Description:Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated.
Residue:412
Sequence:
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50189984
n/a
NameBDBM50189984
Synonyms:CHEMBL378015 | N-phenyl-2-(1-(3,4,5-trimethoxybenzoyl)naphthalen-2-yloxy)acetamide
TypeSmall organic molecule
Emp. Form.C28H25NO6
Mol. Mass.471.5012
SMILESCOc1cc(cc(OC)c1OC)C(=O)c1c(OCC(=O)Nc2ccccc2)ccc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: