| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50200844 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_422599 (CHEMBL911627) |
|---|
| IC50 | 200±n/a nM |
|---|
| Citation |  Lin, LS; Lanza, TJ; Jewell, JP; Liu, P; Shah, SK; Qi, H; Tong, X; Wang, J; Xu, SS; Fong, TM; Shen, CP; Lao, J; Xiao, JC; Shearman, LP; Stribling, DS; Rosko, K; Strack, A; Marsh, DJ; Feng, Y; Kumar, S; Samuel, K; Yin, W; Van der Ploeg, LH; Goulet, MT; Hagmann, WK Discovery of N-[(1S,2S)-3-(4-Chlorophenyl)-2- (3-cyanophenyl)-1-methylpropyl]-2-methyl-2- {[5-(trifluoromethyl)pyridin-2-yl]oxy}propanamide (MK-0364), a novel, acyclic cannabinoid-1 receptor inverse agonist for the treatment of obesity. J Med Chem49:7584-7 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50200844 |
|---|
| n/a |
|---|
| Name | BDBM50200844 |
|---|
| Synonyms: | CHEMBL219480 | N-((2S,3S)-4-(4-chlorophenyl)-3-phenylbutan-2-yl)-2-(3,5-difluorophenoxy)-2-methylpropanamide | N-[(1S,2S)-3-(4-chlorophenyl)-1-methyl-2-phenylpropyl]-2-(3,5-difluorophenyloxy)-2-methylpropanamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H26ClF2NO2 |
|---|
| Mol. Mass. | 457.94 |
|---|
| SMILES | C[C@H](NC(=O)C(C)(C)Oc1cc(F)cc(F)c1)[C@@H](Cc1ccc(Cl)cc1)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
