Reaction Details |
| Report a problem with these data |
Target | Peptide deformylase 1A, chloroplastic/mitochondrial |
---|
Ligand | BDBM50201872 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_423228 (CHEMBL912247) |
---|
IC50 | 450000±n/a nM |
---|
Citation | Boularot, A; Giglione, C; Petit, S; Duroc, Y; Alves de Sousa, R; Larue, V; Cresteil, T; Dardel, F; Artaud, I; Meinnel, T Discovery and refinement of a new structural class of potent peptide deformylase inhibitors. J Med Chem50:10-20 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptide deformylase 1A, chloroplastic/mitochondrial |
---|
Name: | Peptide deformylase 1A, chloroplastic/mitochondrial |
Synonyms: | AtDEF1 | AtDEF1A | DEF1 | DEF1A_ARATH | PDF 1A | PDF1A | Peptide deformylase 1A, chloroplastic | Polypeptide deformylase |
Type: | PROTEIN |
Mol. Mass.: | 30001.50 |
Organism: | Arabidopsis thaliana |
Description: | ChEMBL_423228 |
Residue: | 269 |
Sequence: | MGLHRDEATAMETLFRVSLRLLPVSAAVTCRSIRFPVSRPGSSHLLNRKLYNLPTSSSSS
LSTKAGWLLGLGEKKKKVDLPEIVASGDPVLHEKAREVDPGEIGSERIQKIIDDMIKVMR
LAPGVGLAAPQIGVPLRIIVLEDTKEYISYAPKEEILAQERRHFDLMVMVNPVLKERSNK
KALFFEGCLSVDGFRAAVERYLEVVVTGYDRQGKRIEVNASGWQARILQHECDHLDGNLY
VDKMVPRTFRTVDNLDLPLAEGCPKLGPQ
|
|
|
BDBM50201872 |
---|
n/a |
---|
Name | BDBM50201872 |
Synonyms: | 2-(5-bromo-2-methyl-1H-indolyl)-N-hydroxyacetamide | CHEMBL219460 |
Type | Small organic molecule |
Emp. Form. | C12H13BrN2O2 |
Mol. Mass. | 297.148 |
SMILES | Cc1[nH]c2ccc(Br)cc2c1CC(=O)CNO |
Structure |
|