Reaction Details |
 | Report a problem with these data |
Target | Prostaglandin E2 receptor |
---|
Ligand | BDBM50193918 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_424228 |
---|
Ki | 1.6±n/a nM |
---|
Citation | Belley M; Chan CC; Gareau Y; Gallant M; Juteau H; Houde K; Lachance N; Labelle M; Sawyer N; Tremblay N; Lamontagne S; Carrière MC; Denis D; Greig GM; Slipetz D; Gordon R; Chauret N; Li C; Zamboni RJ; Metters KM Comparison between two classes of selective EP(3) antagonists and their biological activities. Bioorg Med Chem Lett 16:5639-42 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor |
---|
Name: | Prostaglandin E2 receptor |
Synonyms: | PGE receptor, EP3 subtype | PGE2-R | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor |
Type: | Enzyme |
Mol. Mass.: | 43335.03 |
Organism: | Homo sapiens (Human) |
Description: | P43115 |
Residue: | 390 |
Sequence: | MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
|
|
|
BDBM50193918 |
---|
n/a |
---|
Name | BDBM50193918 |
Synonyms: | 3-(2-((E)-3-(4-(benzyloxy)-3-methoxyphenyl)prop-1-enyl)phenyl)-N-(thiophen-2-ylsulfonyl)acrylamide | CHEMBL385955 |
Type | Small organic molecule |
Emp. Form. | C30H27NO5S2 |
Mol. Mass. | 545.669 |
SMILES | COc1cc(C\C=C\c2ccccc2\C=C\C(=O)NS(=O)(=O)c2cccs2)ccc1OCc1ccccc1 |
Structure |
|