| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP3 subtype |
|---|
| Ligand | BDBM50097792 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_424228 (CHEMBL909002) |
|---|
| Ki | 47±n/a nM |
|---|
| Citation |  Belley, M; Chan, CC; Gareau, Y; Gallant, M; Juteau, H; Houde, K; Lachance, N; Labelle, M; Sawyer, N; Tremblay, N; Lamontagne, S; Carrière, MC; Denis, D; Greig, GM; Slipetz, D; Gordon, R; Chauret, N; Li, C; Zamboni, RJ; Metters, KM Comparison between two classes of selective EP(3) antagonists and their biological activities. Bioorg Med Chem Lett16:5639-42 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP3 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP3 subtype |
|---|
| Synonyms: | PE2R3_HUMAN | PGE receptor, EP3 subtype | PGE2-R | PTGER3 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43335.03 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43115 |
|---|
| Residue: | 390 |
|---|
| Sequence: | MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
|
|
|
|---|
| BDBM50097792 |
|---|
| n/a |
|---|
| Name | BDBM50097792 |
|---|
| Synonyms: | (E)-3-(2-Naphthalen-2-ylmethyl-phenyl)-acrylic acid | 3-(2-(naphthalen-2-ylmethyl)phenyl)acrylic acid | CHEMBL423815 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H16O2 |
|---|
| Mol. Mass. | 288.3398 |
|---|
| SMILES | OC(=O)\C=C\c1ccccc1Cc1ccc2ccccc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
