Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor
LigandBDBM50097792
Substrate/Competitorn/a
Meas. Tech.ChEMBL_424228
Ki 47±n/a nM
Citation Belley MChan CCGareau YGallant MJuteau HHoude KLachance NLabelle MSawyer NTremblay NLamontagne SCarrière MCDenis DGreig GMSlipetz DGordon RChauret NLi CZamboni RJMetters KM Comparison between two classes of selective EP(3) antagonists and their biological activities. Bioorg Med Chem Lett 16:5639-42 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor, EP3 subtype | PGE2-R | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor
Type:Enzyme
Mol. Mass.:43335.03
Organism:Homo sapiens (Human)
Description:P43115
Residue:390
Sequence:
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50097792
n/a
NameBDBM50097792
Synonyms:(E)-3-(2-Naphthalen-2-ylmethyl-phenyl)-acrylic acid | 3-(2-(naphthalen-2-ylmethyl)phenyl)acrylic acid | CHEMBL423815
TypeSmall organic molecule
Emp. Form.C20H16O2
Mol. Mass.288.3398
SMILESOC(=O)\C=C\c1ccccc1Cc1ccc2ccccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: