Reaction Details |
| Report a problem with these data |
Target | Thromboxane A2 receptor |
---|
Ligand | BDBM50193935 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_424244 (CHEMBL909018) |
---|
Ki | >500±n/a nM |
---|
Citation | Belley, M; Chan, CC; Gareau, Y; Gallant, M; Juteau, H; Houde, K; Lachance, N; Labelle, M; Sawyer, N; Tremblay, N; Lamontagne, S; Carrière, MC; Denis, D; Greig, GM; Slipetz, D; Gordon, R; Chauret, N; Li, C; Zamboni, RJ; Metters, KM Comparison between two classes of selective EP(3) antagonists and their biological activities. Bioorg Med Chem Lett16:5639-42 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Thromboxane A2 receptor |
---|
Name: | Thromboxane A2 receptor |
Synonyms: | Prostanoid TP receptor | TA2R_HUMAN | TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta |
Type: | Enyzme |
Mol. Mass.: | 37445.28 |
Organism: | Homo sapiens (Human) |
Description: | P21731 |
Residue: | 343 |
Sequence: | MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
|
|
|
BDBM50193935 |
---|
n/a |
---|
Name | BDBM50193935 |
Synonyms: | 3-(2-((6-(benzyloxy)naphthalen-2-yl)methyl)phenyl)-N-(5-bromo-2-methoxyphenylsulfonyl)acrylamide | CHEMBL217941 |
Type | Small organic molecule |
Emp. Form. | C34H28BrNO5S |
Mol. Mass. | 642.559 |
SMILES | COc1ccc(Br)cc1S(=O)(=O)NC(=O)\C=C\c1ccccc1Cc1ccc2cc(OCc3ccccc3)ccc2c1 |
Structure |
|