Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor EP4 subtype
LigandBDBM50193931
Substrate/Competitorn/a
Meas. Tech.ChEMBL_424229
Ki 610±n/a nM
Citation Belley MChan CCGareau YGallant MJuteau HHoude KLachance NLabelle MSawyer NTremblay NLamontagne SCarrière MCDenis DGreig GMSlipetz DGordon RChauret NLi CZamboni RJMetters KM Comparison between two classes of selective EP(3) antagonists and their biological activities. Bioorg Med Chem Lett 16:5639-42 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor EP4 subtype
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor EP4 subtype | PGE2 receptor EP4 subtype | PTGER2 | PTGER4 | Prostanoid EP4 receptor
Type:Enzyme
Mol. Mass.:53134.53
Organism:Homo sapiens (Human)
Description:P35408
Residue:488
Sequence:
MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
LNLSEKCI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50193931
n/a
NameBDBM50193931
Synonyms:3-(2-(4-(benzyloxy)-3-methoxycinnamyl)phenyl)acrylic acid | CHEMBL218626
TypeSmall organic molecule
Emp. Form.C26H24O4
Mol. Mass.400.4664
SMILESCOc1cc(\C=C\Cc2ccccc2\C=C\C(O)=O)ccc1OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: