| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor |
|---|
| Ligand | BDBM50193938 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_424228 |
|---|
| Ki | 1.6±n/a nM |
|---|
| Citation |  Belley M; Chan CC; Gareau Y; Gallant M; Juteau H; Houde K; Lachance N; Labelle M; Sawyer N; Tremblay N; Lamontagne S; Carrière MC; Denis D; Greig GM; Slipetz D; Gordon R; Chauret N; Li C; Zamboni RJ; Metters KM Comparison between two classes of selective EP(3) antagonists and their biological activities. Bioorg Med Chem Lett 16:5639-42 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor |
|---|
| Name: | Prostaglandin E2 receptor |
|---|
| Synonyms: | PGE receptor, EP3 subtype | PGE2-R | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43335.03 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43115 |
|---|
| Residue: | 390 |
|---|
| Sequence: | MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
|
|
|
|---|
| BDBM50193938 |
|---|
| n/a |
|---|
| Name | BDBM50193938 |
|---|
| Synonyms: | 3-(2-(4-(benzyloxy)-3-methoxycinnamyl)phenyl)-N-(thiophen-2-ylsulfonyl)acrylamide | CHEMBL218280 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H27NO5S2 |
|---|
| Mol. Mass. | 545.669 |
|---|
| SMILES | COc1cc(\C=C\Cc2ccccc2\C=C\C(=O)NS(=O)(=O)c2cccs2)ccc1OCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
