| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thymidylate kinase |
|---|
| Ligand | BDBM50131909 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_429556 (CHEMBL919554) |
|---|
| Ki | 57000±n/a nM |
|---|
| Citation |  Vanheusden, V; Munier-Lehmann, H; Froeyen, M; Busson, R; Rozenski, J; Herdewijn, P; Van Calenbergh, S Discovery of bicyclic thymidine analogues as selective and high-affinity inhibitors of Mycobacterium tuberculosis thymidine monophosphate kinase. J Med Chem47:6187-94 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Thymidylate kinase |
|---|
| Name: | Thymidylate kinase |
|---|
| Synonyms: | KTHY_MYCTU | TMPK | Thymidine monophosphate kinase | dTMP kinase | tmk |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22636.29 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | ChEMBL_208218 |
|---|
| Residue: | 214 |
|---|
| Sequence: | MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLA
SSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWV
QRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYA
ELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
|
|
|
|---|
| BDBM50131909 |
|---|
| n/a |
|---|
| Name | BDBM50131909 |
|---|
| Synonyms: | 1-((2R,4R,5S)-4-aminomethyl-5-hydroxymethyl-tetrahydro-furan-2-yl)-5-methyl-1H-pyrimidine-2,4-dione | 1-(4-Aminomethyl-5-hydroxymethyl-tetrahydro-furan-2-yl)-5-methyl-1H-pyrimidine-2,4-dione | CHEMBL341264 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H17N3O4 |
|---|
| Mol. Mass. | 255.2704 |
|---|
| SMILES | Cc1cn([C@H]2C[C@H](CN)[C@@H](CO)O2)c(=O)[nH]c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
