Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDelta-type opioid receptor
LigandBDBM50157798
Substrate/Competitorn/a
Meas. Tech.ChEMBL_430160
EC50 3.9±n/a nM
Citation Srivastava SKShefali SMiller CNAceto MDTraynor JRLewis JWHusbands SM Effects of substitution on the pyrrole N atom in derivatives of tetrahydronaltrindole, tetrahydrooxymorphindole, and a related 4,5-epoxyphenylpyrrolomorphinan. J Med Chem 47:6645-8 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Delta-type opioid receptor
Name:Opioid receptors; mu/kappa/delta
Synonyms:D-OR-1 | DOR-1 | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRK1 | opioid receptor, delta 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40382.98
Organism:Homo sapiens (Human)
Description:Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor.
Residue:372
Sequence:
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50157798
n/a
NameBDBM50157798
Synonyms:CHEMBL222597 | l',17-dicyclopropylmethyl-6-7-didehydro-3,14-dihydroxy-4,5alpha-epoxy-4',5',6',7'-tetrahydroindolo[2',3';6,7]morphinan
TypeSmall organic molecule
Emp. Form.C30H36N2O3
Mol. Mass.472.6184
SMILESOc1ccc2CC3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)c1c(C[C@@]35O)c2CCCCc2n1CC1CC1 |r,TLB:3:4:22:13.12.7,17:18:22:13.12.7|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: