Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50158535 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_430598 (CHEMBL918700) |
---|
IC50 | 22000±n/a nM |
---|
Citation | Gangjee, A; Zeng, Y; McGuire, JJ; Mehraein, F; Kisliuk, RL Synthesis of classical, three-carbon-bridged 5-substituted furo[2,3-d]pyrimidine and 6-substituted pyrrolo[2,3-d]pyrimidine analogues as antifolates. J Med Chem47:6893-901 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
Type: | n/a |
Mol. Mass.: | 17532.46 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 157 |
Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
BDBM50158535 |
---|
n/a |
---|
Name | BDBM50158535 |
Synonyms: | CHEMBL374172 | N-{4-[3-(2-amino-3,4-dihydro-4-oxo-7H-pyrrolo[2,3-d]-pyrimidin-6-yl)propyl]benzoyl}-L-glutamic acid |
Type | Small organic molecule |
Emp. Form. | C21H23N5O6 |
Mol. Mass. | 441.4372 |
SMILES | Nc1nc2[nH]cc(CCCc3ccc(cc3)C(=O)N[C@@H](CCC(O)=O)C(O)=O)c2c(=O)[nH]1 |r| |
Structure |
|