Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTripeptidyl aminopeptidase
LigandBDBM50176922
Substrate/Competitorn/a
Meas. Tech.ChEMBL_430943
Ki 340±n/a nM
Citation Ganellin CRBishop PBBambal RBChan SMLeblond BMoore ANZhao LBourgeat PRose CVargas FSchwartz JC Inhibitors of tripeptidyl peptidase II. 3. Derivation of butabindide by successive structure optimizations leading to a potential general approach to designing exopeptidase inhibitors. J Med Chem 48:7333-42 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tripeptidyl aminopeptidase
Name:Tripeptidyl aminopeptidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:138287.08
Organism:Rattus norvegicus
Description:ChEMBL_211948
Residue:1249
Sequence:
MATAATEEPFPFHGLLPKKETGASSFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDG
KPKIIDIIDTTGSGDVNTATEVEPKDGEITGLSGRVLKIPANWTNPSGKYHIGIKNGYDF
YPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVEL
LNSFEKKYSDPGPVYDCLVWHDGETWRACVDSNENGDLGKSTVLRNYKEAQEYGSFGTAE
MLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTR
LSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNTIYVSSA
GNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLREKLPANQYTWSSRGPSADGAL
GVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKANNVDYTVHSVRR
ALENTAIKADNIEVFAQGHGIIQVDKAYDYLIQNTSFANRLGFTVTVGNNRGIYLRDPVQ
VAAPSDHGVGIEPVFPENTENSEKISFQLHLALTSNSSWVQCPSHLELMNQCRHINIRVD
PRGLREGLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESSHYDLAFTDVHFKPGQIR
RHFVEVPEGATWAEVTVCSCSSEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLIE
AFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLK
YEDLAPCITLKSWVQTLRPVNAKTRPLGSRDVLPNNRQLYEMVLTYSFHQPKSGEVTPSC
PLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQYSLKLEKGDYTIRLQIRHEQISDL
DRLKDLPFIVSHRLSNTLSLDIHENHSLALLGKKKSSSLTLPPKYNQPFFVTSLPDDKIP
KGAGPGCYLAGSLTLSKTELGKKADVIPVHYYLIPPPTKTKNGSKDKEKDSEKEKDLKEE
FTEALRDLKIQWMTKLDSTDIYNELKETYPAYLPLYVARLHQLDAEKERMKRLNEIVDAA
NAVISHIDQTALAVYIAMKTDPRPDAATIKNDMDKQKSTLVDALCRKGCALADHLLHAQP
HDGAAAGDAEAKEEEGESTLESLSETYWETTKWTDLFDTKVLTFAYKHALVNKMYGRGLK
FATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYPPDYCVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50176922
n/a
NameBDBM50176922
Synonyms:(2S)-aminobutyryl-(2S)-indoline carboxylic acid methylamide | CHEMBL224398
TypeSmall organic molecule
Emp. Form.C14H19N3O2
Mol. Mass.261.3196
SMILESCC[C@H](N)C(=O)N1[C@@H](Cc2ccccc12)C(=O)NC |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: