Reaction Details |
| Report a problem with these data |
Target | Bcl-2-like protein 2 |
---|
Ligand | BDBM50107132 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_441639 (CHEMBL891870) |
---|
Ki | 127000±n/a nM |
---|
Citation | Xing, C; Wang, L; Tang, X; Sham, YY Development of selective inhibitors for anti-apoptotic Bcl-2 proteins from BHI-1. Bioorg Med Chem15:2167-76 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl-2-like protein 2 |
---|
Name: | Bcl-2-like protein 2 |
Synonyms: | Apoptosis regulator Bcl-W | B2CL2_HUMAN | BCL-W | BCL2L2 | BCLW | Bcl-2-like protein 2 | Bcl2-L-2 | KIAA0271 |
Type: | Protein |
Mol. Mass.: | 20742.61 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 193 |
Sequence: | MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
GALVTVGAFFASK
|
|
|
BDBM50107132 |
---|
n/a |
---|
Name | BDBM50107132 |
Synonyms: | (2R,3S,6S,7R,8R)-8-butyl-3-(3-formamido-2-hydroxybenzamido)-2,6-dimethyl-4,9-dioxo-1,5-dioxonan-7-yl 3-methylbutanoate | 3-Methyl-butyric acid (2R,3S,6S,7R,8R)-8-butyl-3-(3-formylamino-2-hydroxy-benzoylamino)-2,6-dimethyl-4,9-dioxo-[1,5]dioxonan-7-yl ester | 3-Methyl-butyric acid 8-butyl-3-(3-formylamino-2-hydroxy-benzoylamino)-2,6-dimethyl-4,9-dioxo-[1,5]dioxonan-7-yl ester | Antimycin A3 | CHEMBL436605 |
Type | Small organic molecule |
Emp. Form. | C26H36N2O9 |
Mol. Mass. | 520.572 |
SMILES | CCCC[C@@H]1[C@@H](OC(=O)CC(C)C)[C@H](C)OC(=O)[C@@H](NC(=O)c2cccc(NC=O)c2O)[C@@H](C)OC1=O |
Structure |
|