Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 4
LigandBDBM50027536
Substrate/Competitorn/a
Meas. Tech.ChEMBL_442425
Ki 820000±n/a nM
Citation Temperini CInnocenti AGuerri AScozzafava ARusconi SSupuran CT Phosph(on)ate as a zinc-binding group in metalloenzyme inhibitors: X-ray crystal structure of the antiviral drug foscarnet complexed to human carbonic anhydrase I. Bioorg Med Chem Lett 17:2210-5 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 4
Name:Carbonic anhydrase
Synonyms:CA-IV | Carbonate dehydratase IV | Carbonic anhydrase 4 (CA IV) | Carbonic anhydrase IV (CA IV)
Type:Enzyme
Mol. Mass.:35037.98
Organism:Homo sapiens (Human)
Description:P22748
Residue:312
Sequence:
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTK
AKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSD
LPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
QPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFRE
PIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
PMLACLLAGFLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027536
n/a
NameBDBM50027536
Synonyms:(phosphonoformate)Trisodium phosphonoformate | Antiviral agent : Inhibitor of reverse transcriptase of Human T-cell lymphotropic, virus type III, useful in the treatment of HSV-1 infections | CHEMBL754 | EHB-776 | FOSCARNET SODIUM | Foscarnet | Foscavir | phosphonoformate trisodium salt | trisodium dioxidophosphinecarboxylate oxide | trisodium dioxidophosphinecarboxylate oxide with 6 molecules of water(foscarnet) | trisodium phosphonoformate
TypeSmall organic molecule
Emp. Form.CO5P
Mol. Mass.122.9831
SMILES[O-]C(=O)P([O-])([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: