| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 2C |
|---|
| Ligand | BDBM50222859 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_446533 (CHEMBL896830) |
|---|
| Ki | 120±n/a nM |
|---|
| Citation |  Rudolph, J; Esler, WP; O'connor, S; Coish, PD; Wickens, PL; Brands, M; Bierer, DE; Bloomquist, BT; Bondar, G; Chen, L; Chuang, CY; Claus, TH; Fathi, Z; Fu, W; Khire, UR; Kristie, JA; Liu, XG; Lowe, DB; McClure, AC; Michels, M; Ortiz, AA; Ramsden, PD; Schoenleber, RW; Shelekhin, TE; Vakalopoulos, A; Tang, W; Wang, L; Yi, L; Gardell, SJ; Livingston, JN; Sweet, LJ; Bullock, WH Quinazolinone derivatives as orally available ghrelin receptor antagonists for the treatment of diabetes and obesity. J Med Chem50:5202-16 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 2C |
|---|
| Name: | 5-hydroxytryptamine receptor 2C |
|---|
| Synonyms: | 5-HT-2C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | 5HT2C_HUMAN | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 51836.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P28335 |
|---|
| Residue: | 458 |
|---|
| Sequence: | MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
|
|
|
|---|
| BDBM50222859 |
|---|
| n/a |
|---|
| Name | BDBM50222859 |
|---|
| Synonyms: | 6-(4-chlorophenyl)-3-{[(3S)-1-ethylpiperidin-3-yl]methyl}-2-(2-methylphenyl)quinazolin-4(3H)-one | CHEMBL243884 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H30ClN3O |
|---|
| Mol. Mass. | 472.021 |
|---|
| SMILES | CCN1CCC[C@H](Cn2c(nc3ccc(cc3c2=O)-c2ccc(Cl)cc2)-c2ccccc2C)C1 |
|---|
| Structure | 
|
|---|
Search and Browse
