Reaction Details |
| Report a problem with these data |
Target | Growth hormone secretagogue receptor type 1 |
---|
Ligand | BDBM50222888 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_446527 (CHEMBL895698) |
---|
Ki | 71±n/a nM |
---|
Citation | Rudolph, J; Esler, WP; O'connor, S; Coish, PD; Wickens, PL; Brands, M; Bierer, DE; Bloomquist, BT; Bondar, G; Chen, L; Chuang, CY; Claus, TH; Fathi, Z; Fu, W; Khire, UR; Kristie, JA; Liu, XG; Lowe, DB; McClure, AC; Michels, M; Ortiz, AA; Ramsden, PD; Schoenleber, RW; Shelekhin, TE; Vakalopoulos, A; Tang, W; Wang, L; Yi, L; Gardell, SJ; Livingston, JN; Sweet, LJ; Bullock, WH Quinazolinone derivatives as orally available ghrelin receptor antagonists for the treatment of diabetes and obesity. J Med Chem50:5202-16 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Growth hormone secretagogue receptor type 1 |
---|
Name: | Growth hormone secretagogue receptor type 1 |
Synonyms: | Ghrelin receptor |
Type: | PROTEIN |
Mol. Mass.: | 41494.35 |
Organism: | Ovis aries |
Description: | ChEMBL_446527 |
Residue: | 366 |
Sequence: | MWNATRSEELGPNLTLPDLDWDAAPDNDSLTDELPPLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWHYRPWNLGDLLCKLFQ
FVSESCTYASVLTITALSVERYFAICFPLRAKVVITKGRVKLVVLAIWAVAFCSAWPIFM
LVGVEHENGTDPRDTNECRATEFAVRSGLLTIMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRSEVVVGASLRDQNHKQTVKMLAVVVFAFVLCWLPFHVGRYLFSKSFEPGSVEIAQI
SQYCNLVSFVLFYFSAAINPILYNIMSKKYRVAVFKLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
BDBM50222888 |
---|
n/a |
---|
Name | BDBM50222888 |
Synonyms: | 6-(4-chlorophenyl)-3-{[(3R)-1-ethylpiperidin-3-yl]methyl}-2-(2-methylphenyl)quinazolin-4(3H)-one | CHEMBL244073 |
Type | Small organic molecule |
Emp. Form. | C29H30ClN3O |
Mol. Mass. | 472.021 |
SMILES | CCN1CCC[C@@H](Cn2c(nc3ccc(cc3c2=O)-c2ccc(Cl)cc2)-c2ccccc2C)C1 |
Structure |
|