Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target12-Lipoxygenase (12-LOX)
LigandBDBM50221402
Substrate/Competitorn/a
Meas. Tech.ChEMBL_449592
IC50 210±n/a nM
Citation Deschamps JDGautschi JTWhitman SJohnson TAGassner NCCrews PHolman TR Discovery of platelet-type 12-human lipoxygenase selective inhibitors by high-throughput screening of structurally diverse libraries. Bioorg Med Chem 15:6900-8 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
12-Lipoxygenase (12-LOX)
Name:Arachidonate 12-lipoxygenase
Synonyms:12-LOX | Arachidonate 12-lipoxygenase | Arachidonate 12-lipoxygenase, 12S-type | Platelet 12-lipoxygenase | Platelet-type lipoxygenase 12
Type:Protein
Mol. Mass.:75689.18
Organism:Homo sapiens (Human)
Description:P18054
Residue:663
Sequence:
MGRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFDHDVAEDLGLL
QFVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNA
LDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKA
GALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPML
LRRSTSLPSRLVLPSGMEELQAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPL
VMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYH
LLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVST
GGGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVH
LFYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQH
AAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRR
QPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENS
VTI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50221402
n/a
NameBDBM50221402
Synonyms:CHEMBL238624 | NSC-172033
TypeSmall organic molecule
Emp. Form.C26H14Cl8O4
Mol. Mass.674.011
SMILESOc1c(Cl)cc(cc1Cl)C(C(c1cc(Cl)c(O)c(Cl)c1)c1cc(Cl)c(O)c(Cl)c1)c1cc(Cl)c(O)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: