Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase pim-2 |
---|
Ligand | BDBM50222913 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_450002 (CHEMBL898066) |
---|
IC50 | 1720±n/a nM |
---|
Citation | Teng, M; Zhu, J; Johnson, MD; Chen, P; Kornmann, J; Chen, E; Blasina, A; Register, J; Anderes, K; Rogers, C; Deng, Y; Ninkovic, S; Grant, S; Hu, Q; Lundgren, K; Peng, Z; Kania, RS Structure-based design and synthesis of (5-arylamino-2H-pyrazol-3-yl)-biphenyl-2',4'-diols as novel and potent human CHK1 inhibitors. J Med Chem50:5253-6 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase pim-2 |
---|
Name: | Serine/threonine-protein kinase pim-2 |
Synonyms: | PIM2 | PIM2_HUMAN | Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase pim-2 (PIM2) |
Type: | Serine/threonine-protein kinase |
Mol. Mass.: | 34185.93 |
Organism: | Homo sapiens (Human) |
Description: | Q9P1W9 |
Residue: | 311 |
Sequence: | MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
|
|
|
BDBM50222913 |
---|
n/a |
---|
Name | BDBM50222913 |
Synonyms: | 4'-{5-[4-(isopropylamino-methyl)-phenylamino]-2H-pyrazol-3-yl}-biphenyl-2,4-diol | CHEMBL398606 |
Type | Small organic molecule |
Emp. Form. | C25H26N4O2 |
Mol. Mass. | 414.4995 |
SMILES | CC(C)NCc1ccc(Nc2cc(n[nH]2)-c2ccc(cc2)-c2ccc(O)cc2O)cc1 |
Structure |
|