Reaction Details |
| Report a problem with these data |
Target | C-X-C chemokine receptor type 2 |
---|
Ligand | BDBM50203033 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_454110 (CHEMBL903301) |
---|
IC50 | 37±n/a nM |
---|
Citation | McCleland, BW; Davis, RS; Palovich, MR; Widdowson, KL; Werner, ML; Burman, M; Foley, JJ; Schmidt, DB; Sarau, HM; Rogers, M; Salyers, KL; Gorycki, PD; Roethke, TJ; Stelman, GJ; Azzarano, LM; Ward, KW; Busch-Petersen, J Comparison of N,N'-diarylsquaramides and N,N'-diarylureas as antagonists of the CXCR2 chemokine receptor. Bioorg Med Chem Lett17:1713-7 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-X-C chemokine receptor type 2 |
---|
Name: | C-X-C chemokine receptor type 2 |
Synonyms: | C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | CXCR2 | CXCR2_HUMAN | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | IL8RB | Interleukin-8 receptor B |
Type: | Protein |
Mol. Mass.: | 40767.88 |
Organism: | Homo sapiens (Human) |
Description: | P25025 |
Residue: | 360 |
Sequence: | MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
|
|
|
BDBM50203033 |
---|
n/a |
---|
Name | BDBM50203033 |
Synonyms: | 3-(2-bromophenylamino)-4-(2-hydroxy-4-nitrophenylamino)cyclobut-3-ene-1,2-dione | CHEMBL239348 |
Type | Small organic molecule |
Emp. Form. | C16H10BrN3O5 |
Mol. Mass. | 404.172 |
SMILES | Oc1cc(ccc1Nc1c(Nc2ccccc2Br)c(=O)c1=O)[N+]([O-])=O |
Structure |
|