Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP2 subtype |
---|
Ligand | BDBM35847 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_458316 (CHEMBL925647) |
---|
Ki | 4.90±n/a nM |
---|
Citation | Zhao, Z; Araldi, GL; Xiao, Y; Reddy, AP; Liao, Y; Karra, S; Brugger, N; Fischer, D; Palmer, E Synthesis and evaluation of novel pyrazolidinone analogs of PGE2 as EP2 and EP4 receptors agonists. Bioorg Med Chem Lett17:6572-5 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP2 subtype |
---|
Name: | Prostaglandin E2 receptor EP2 subtype |
Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
Type: | Enzyme |
Mol. Mass.: | 39775.71 |
Organism: | Homo sapiens (Human) |
Description: | P43116 |
Residue: | 358 |
Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
BDBM35847 |
---|
n/a |
---|
Name | BDBM35847 |
Synonyms: | (15S)-prostaglandin E2 | (5Z,11alpha,13E,15S)-11,15-dihydroxy-9-oxoprosta-5,13-dien-1-oic acid | (5Z,13E,15S)-11alpha,15-dihydroxy-9-oxoprosta-5,13-dien-1-oic acid | (E,Z)-(1R,2R,3R)-7-(3-Hydroxy-2-((3S)-(3-hydroxy-1-octenyl))-5-oxocyclopentyl)-5-heptenoic acid | CHEMBL548 | DINOPROSTONE | PGE2 | [3H]Dinoprostone | [3H]PGE2 | [3H]Prostaglandin E2 | prostaglandin E2 |
Type | radiolabeled ligand |
Emp. Form. | C20H32O5 |
Mol. Mass. | 352.4651 |
SMILES | CCCCC[C@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1C\C=C/CCCC(O)=O |
Structure |
|