Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-activated protein kinase 5
LigandBDBM50224883
Substrate/Competitorn/a
Meas. Tech.ChEMBL_458486
Ki>1525±n/a nM
Citation Tao ZFChen ZBui MHKovar PJohnson EBouska JZhang HRosenberg SSowin TLin NH Macrocyclic ureas as potent and selective Chk1 inhibitors: an improved synthesis, kinome profiling, structure-activity relationships, and preliminary pharmacokinetics. Bioorg Med Chem Lett 17:6593-601 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-activated protein kinase 5
Name:MAP kinase-activated protein kinase 5
Synonyms:MAP kinase-activated protein kinase 5 (PRAK) | MAPK-Activated Protein Kinase 5 (MK5) | MAPK-activated protein kinase 5 | MAPKAP kinase 5 | PRAK | p38-regulated/activated protein kinase | p38-regulated/activated protein kinase (PRAK)
Type:Serine/threonine-protein kinase
Mol. Mass.:54229.92
Organism:Homo sapiens (Human)
Description:Recombinant MAPKAPK5 was phosphorylated by incubation with active p38alpha before assays.
Residue:473
Sequence:
MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKAR
NEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHF
TEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDL
MTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPP
FYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLD
HPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPIL
RKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQ
EAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50224883
n/a
NameBDBM50224883
Synonyms:7-chloro-3-oxo-8-[(thiazol-5-ylmethyl)-amino]-11,16-dioxa-2,4,19,21-tetraaza-tricyclo[15.3.1.0*5,10*]henicosa-1(21),5,7,9,17,19-hexaene-18-crbonitrile | CHEMBL248757
TypeSmall organic molecule
Emp. Form.C20H18ClN7O3S
Mol. Mass.471.92
SMILESClc1cc2NC(=O)Nc3cnc(C#N)c(OCCCCOc2cc1NCc1cncs1)n3
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: