Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5'-AMP-activated protein kinase subunit beta-1
LigandBDBM50224883
Substrate/Competitorn/a
Meas. Tech.ChEMBL_458404
Ki 1539±n/a nM
Citation Tao ZFChen ZBui MHKovar PJohnson EBouska JZhang HRosenberg SSowin TLin NH Macrocyclic ureas as potent and selective Chk1 inhibitors: an improved synthesis, kinome profiling, structure-activity relationships, and preliminary pharmacokinetics. Bioorg Med Chem Lett 17:6593-601 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5'-AMP-activated protein kinase subunit beta-1
Name:5'-AMP-activated protein kinase subunit beta-1
Synonyms:5'-AMP-activated protein kinase subunit beta-1 (AMPK) | 5''''''''''''''''-AMP-activated protein kinase subunit beta-1 | 5''''''''-AMP-activated protein kinase catalytic subunit alpha-2/beta-1/gamma-2 | 5''''''''-AMP-activated protein kinase subunit beta-1 | 5''''-AMP-activated protein kinase subunit beta-1 | 5''-AMP-activated protein kinase subunit beta-1 | AMP-activated protein kinase, beta-1 subunit | AMPK | AMPK subunit beta-1 | AMPKb | PRKAB1
Type:n/a
Mol. Mass.:30380.94
Organism:Homo sapiens (Human)
Description:Q9Y478
Residue:270
Sequence:
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50224883
n/a
NameBDBM50224883
Synonyms:7-chloro-3-oxo-8-[(thiazol-5-ylmethyl)-amino]-11,16-dioxa-2,4,19,21-tetraaza-tricyclo[15.3.1.0*5,10*]henicosa-1(21),5,7,9,17,19-hexaene-18-crbonitrile | CHEMBL248757
TypeSmall organic molecule
Emp. Form.C20H18ClN7O3S
Mol. Mass.471.92
SMILESClc1cc2NC(=O)Nc3cnc(C#N)c(OCCCCOc2cc1NCc1cncs1)n3
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: