Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase III
LigandBDBM10880
Substrate/Competitorn/a
Meas. Tech.ChEMBL_459051
Ki 3.1±n/a nM
Citation Supuran CTScozzafava A Carbonic anhydrases as targets for medicinal chemistry. Bioorg Med Chem 15:4336-50 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase III
Name:Carbonic Anhydrase III
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 (CA III) | Carbonic anhydrase III (CA III)
Type:Enzyme
Mol. Mass.:29562.11
Organism:Homo sapiens (Human)
Description:Human cloned isozyme.
Residue:260
Sequence:
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10880
n/a
NameBDBM10880
Synonyms:AZA | AZA2 | AZM acetazolamide | Acerazolamide, AAZ | Acetazolamide | Acetazolamide (AAZ) | Acetazolamide (AZA) | Acetazolamide (AZM) | Acetazolamide, 5 | Acetazolamide, AAZ | Acetazolamide, AZA | Acetazolamide, AZM | CHEMBL20 | N-(5-sulfamoyl-1,3,4-thiadiazol-2-yl)acetamide | Sulfonamide, 1 | US10172837, Acetazolamide | sulfonamide 1
TypeSmall organic molecule
Emp. Form.C4H6N4O3S2
Mol. Mass.222.245
SMILESCC(=O)Nc1nnc(s1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: