| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50231767 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_460795 (CHEMBL944736) |
|---|
| IC50 | >2000±n/a nM |
|---|
| Citation |  Kort, ME; Drizin, I; Gregg, RJ; Scanio, MJ; Shi, L; Gross, MF; Atkinson, RN; Johnson, MS; Pacofsky, GJ; Thomas, JB; Carroll, WA; Krambis, MJ; Liu, D; Shieh, CC; Zhang, X; Hernandez, G; Mikusa, JP; Zhong, C; Joshi, S; Honore, P; Roeloffs, R; Marsh, KC; Murray, BP; Liu, J; Werness, S; Faltynek, CR; Krafte, DS; Jarvis, MF; Chapman, ML; Marron, BE Discovery and biological evaluation of 5-aryl-2-furfuramides, potent and selective blockers of the Nav1.8 sodium channel with efficacy in models of neuropathic and inflammatory pain. J Med Chem51:407-16 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50231767 |
|---|
| n/a |
|---|
| Name | BDBM50231767 |
|---|
| Synonyms: | 5-(4-cyanophenyl)-N-(3-methylphenyl)furan-2-carboxamide | CHEMBL401258 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H14N2O2 |
|---|
| Mol. Mass. | 302.3267 |
|---|
| SMILES | Cc1cccc(NC(=O)c2ccc(o2)-c2ccc(cc2)C#N)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
