| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A1 |
|---|
| Ligand | BDBM50224759 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_461289 (CHEMBL927309) |
|---|
| Ki | 1.87±n/a nM |
|---|
| Citation |  Cappellacci, L; Franchetti, P; Vita, P; Petrelli, R; Lavecchia, A; Costa, B; Spinetti, F; Martini, C; Klotz, KN; Grifantini, M 5'-Carbamoyl derivatives of 2'-C-methyl-purine nucleosides as selective A1 adenosine receptor agonists: affinity, efficacy, and selectivity for A1 receptor from different species. Bioorg Med Chem16:336-53 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A1 |
|---|
| Name: | Adenosine receptor A1 |
|---|
| Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36520.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30542 |
|---|
| Residue: | 326 |
|---|
| Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
|---|
| BDBM50224759 |
|---|
| n/a |
|---|
| Name | BDBM50224759 |
|---|
| Synonyms: | (2R,3R,4S,5R)-2-(2-chloro-6-((R)-tetrahydrofuran-3-ylamino)-9H-purin-9-yl)-5-(hydroxymethyl)-tetrahydrofuran-3,4-diol | CHEMBL252198 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H18ClN5O5 |
|---|
| Mol. Mass. | 371.776 |
|---|
| SMILES | OC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N[C@@H]3CCOC3)nc(Cl)nc12 |
|---|
| Structure | 
|
|---|
Search and Browse
