Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholinesterase
LigandBDBM10620
Substrate/Competitorn/a
Meas. Tech.ChEMBL_462117
IC50 920±n/a nM
Citation Cavalli ABolognesi MLMinarini ARosini MTumiatti VRecanatini MMelchiorre C Multi-target-directed ligands to combat neurodegenerative diseases. J Med Chem 51:347-72 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylcholinesterase
Name:Cholinesterases; ACHE & BCHE
Synonyms:AChE | Acetylcholinesterase (AChE) | Acetylcholinesterase (human AChE)
Type:Enzyme
Mol. Mass.:67792.70
Organism:Homo sapiens (Human)
Description:n/a
Residue:614
Sequence:
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ
YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10620
n/a
NameBDBM10620
Synonyms:(S)-3-(1-(dimethylamino)ethyl)phenyl ethyl(methyl)carbamate | 3-((1S)-1-(Dimethylamino)ethyl)phenyl N-ethyl N-methyl carbamate | 3-(1-(dimethylamino)ethyl)phenyl ethyl(methyl)carbamate | 3-[(1S)-1-(dimethylamino)ethyl]phenyl N-ethyl-N-methylcarbamate | CHEMBL636 | ENA-713 | Ethyl-methyl-carbamic acid 3-((R)-1-dimethylamino-ethyl)-phenyl ester | Ethyl-methyl-carbamic acid 3-((S)-1-dimethylamino-ethyl)-phenyl ester | Ethyl-methyl-carbamic acid 3-(1-dimethylamino-ethyl)-phenyl ester | Exelon | RIVASTIGMINE | Rivastigmine | Rivastigmine (1) | SDZ-212-713 | SDZ-ENA-713
TypeSmall organic molecule
Emp. Form.C14H22N2O2
Mol. Mass.250.3367
SMILES[H][C@@](C)(N(C)C)c1cccc(OC(=O)N(C)CC)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: