Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 3A
LigandBDBM50110300
Substrate/Competitorn/a
Meas. Tech.ChEMBL_462123
Ki 0.330000±n/a nM
Citation Cavalli ABolognesi MLMinarini ARosini MTumiatti VRecanatini MMelchiorre C Multi-target-directed ligands to combat neurodegenerative diseases. J Med Chem 51:347-72 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 3A
Name:Serotonin 3 (5-HT3) receptor
Synonyms:5-HT-3 | 5-HT3 | 5-HT3A | 5-HT3R | 5-hydroxytryptamine receptor 3 (5-HT3) | 5-hydroxytryptamine receptor 3A (5-HT3a) | 5-hydroxytryptamine receptor 3A (5HT3A) | HTR3A | Serotonin 3 (5-HT3) receptor | Serotonin 3 receptor (5HT3) | Serotonin receptor 3A | Serotonin-gated ion channel receptor | Serotonin-gated ion channel receptor 3
Type:Protein
Mol. Mass.:55283.27
Organism:Homo sapiens (Human)
Description:P46098
Residue:478
Sequence:
MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI
LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR
RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ
STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50110300
n/a
NameBDBM50110300
Synonyms:CHEMBL15056 | N-(4-(3-(piperidin-1-yl)propoxy)phenethyl)-5,6,7,8-tetrahydroacridin-9-amine | {2-[4-(3-Piperidin-1-yl-propoxy)-phenyl]-ethyl}-(1,2,3,4-tetrahydro-acridin-9-yl)-amine; Oxalic acid
TypeSmall organic molecule
Emp. Form.C29H37N3O
Mol. Mass.443.6236
SMILESC(COc1ccc(CCNc2c3CCCCc3nc3ccccc23)cc1)CN1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: