Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAmine oxidase [flavin-containing] B
LigandBDBM50231957
Substrate/Competitorn/a
Meas. Tech.ChEMBL_462121
IC50 3.3±n/a nM
Citation Cavalli ABolognesi MLMinarini ARosini MTumiatti VRecanatini MMelchiorre C Multi-target-directed ligands to combat neurodegenerative diseases. J Med Chem 51:347-72 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Amine oxidase [flavin-containing] B
Name:Amine oxidase [flavin-containing] B
Synonyms:MAO-B | Monoamine oxidase type B | Monoamine oxidase type B (MAO B) | Monoamine oxidase type B (MAO B) | Monoamine oxidase type B (MAOB)
Type:Protein
Mol. Mass.:58768.76
Organism:Homo sapiens (Human)
Description:P27338
Residue:520
Sequence:
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50231957
n/a
NameBDBM50231957
Synonyms:7-(3-Chloro-benzyloxy)-3,4-dimethyl-chromen-2-one | 7-(3-chlorobenzyloxy)-3,4-dimethyl-2H-chromen-2-one | CHEMBL109018
TypeSmall organic molecule
Emp. Form.C18H15ClO3
Mol. Mass.314.763
SMILESCc1c(C)c(=O)oc2cc(OCc3cccc(Cl)c3)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: